PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01037031001
Common NameLOC100249782, VIT_03s0088g00550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 214aa    MW: 23835.6 Da    PI: 10.1513
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01037031001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.56.4e-222064549
                       SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +sn qvtfskRr g++KKA+EL++LC++e+a+++fs+  k+y +
  GSVIVT01037031001 20 KESNLQVTFSKRRSGLFKKASELCTLCGVEIAIVVFSPGKKVYSF 64
                       57999**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.469868IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-28867IPR002100Transcription factor, MADS-box
CDDcd002656.05E-32978No hitNo description
SuperFamilySSF554551.44E-25982IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-171030IPR002100Transcription factor, MADS-box
PfamPF003192.1E-241864IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-173045IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-174566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0025502developmental stagefruit ripening stage
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MATVRKSKGR QRVEMAKMTK ESNLQVTFSK RRSGLFKKAS ELCTLCGVEI AIVVFSPGKK  60
VYSFGHPCVE SIIDRFLTRN PLPNSSALQL FEAHRSANVR DLNLQLTQVL NQLEIEKKRG  120
EALTQMRKAS QAQCWWAASI EELSFERLEL LKVSLENLKK NVALQVDKLM IEASNPPTFF  180
PSNSVGAVVP YDSQVAGFGP RSYDFGYGGG RLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4327350.0AM432735.2 Vitis vinifera contig VV78X229996.16, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271109.11e-158PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK25e-67AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7T3N41e-158D7T3N4_VITVI; Putative uncharacterized protein
STRINGVIT_03s0088g00550.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-60AGAMOUS-like 62